PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold00936-abinit-gene-0.1-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NF-YB
Protein Properties Length: 149aa    MW: 16846.8 Da    PI: 6.2708
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold00936-abinit-gene-0.1-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB158.11.4e-49496395
                                                 NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrkt 61
                                                          eq+r+lPianv+rimk++lP  akisk+ak+t+qec++efisfvt+easdkc++e+rkt
  augustus_masked-scaffold00936-abinit-gene-0.1-mRNA-1  4 EQERLLPIANVGRIMKQILPPTAKISKEAKQTMQECATEFISFVTAEASDKCHKENRKT 62
                                                          89********************************************************* PP

                                                 NF-YB 62 ingddllwalatlGfedyveplkvylkkyreleg 95
                                                          +ngdd++wal+tlGf++y+e++  yl kyre+e+
  augustus_masked-scaffold00936-abinit-gene-0.1-mRNA-1 63 VNGDDICWALSTLGFDNYAEAIVRYLYKYREAER 96
                                                          *******************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.5E-503116IPR009072Histone-fold
SuperFamilySSF471137.3E-395119IPR009072Histone-fold
PfamPF008081.1E-26872IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.4E-183654No hitNo description
PRINTSPR006154.4E-185573No hitNo description
PRINTSPR006154.4E-187492No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MDDEQERLLP IANVGRIMKQ ILPPTAKISK EAKQTMQECA TEFISFVTAE ASDKCHKENR  60
KTVNGDDICW ALSTLGFDNY AEAIVRYLYK YREAERLKAN QNKGNGTPDN HEEESNYGSG  120
GPHGRQTKLP IPLEFRVMER GDNSQARPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-40493392Transcription factor HapC (Eurofung)
4g92_B2e-40493392Transcription factor HapC (Eurofung)
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00133DAPTransfer from AT1G09030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007030959.11e-71Nuclear transcription factor Y subunit B-4
SwissprotO040273e-60NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLA0A061F3311e-71A0A061F331_THECC; Nuclear transcription factor Y subunit B-4
STRINGVIT_14s0060g02660.t012e-69(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.12e-61nuclear factor Y, subunit B4